Skip to the beginning of the images gallery

PrEST Antigen LRCH2

Name: PrEST Antigen LRCH2
Brand: Atlas Antibodies
SKU: ATLAPrEST95861-100

leucine rich repeats and calponin homology domain containing 2

SKU

ATLAPrEST95861-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: LRCH2

Sequence: RNKPKQTVECEKSVSADEVNSPLSPLTWQPLENQKDQIDEQPWPESHPIIWQSEERRRSKQIRKEYFKYKSMRKSSSGNENDEQDSDNANMSTQSPVS

Interspecies Mouse/Rat: ENSRNOG00000029582: 86%, ENSMUSG00000031290: 85%

Entrez Gene ID: 57631

UniProt ID: Q5VUJ6

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000130224

More Information
SKU	ATLAPrEST95861-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95861-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	57631
Product information (PDF)	Download
MSDS (PDF)	Download