Skip to the beginning of the images gallery

PrEST Antigen LRRC31

Name: PrEST Antigen LRRC31
Brand: Atlas Antibodies
SKU: ATLAPrEST95626-100

leucine rich repeat containing 31

SKU

ATLAPrEST95626-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: LRRC31

Sequence: NVRFLKELIELDISLRPSNFRDCGQWFRHLLYAVTKLPQITEIGMKRWILPASQEEELECFDQDKKRSIHFDHGGF

Interspecies Mouse/Rat: ENSMUSG00000074653: 71%, ENSRNOG00000027971: 68%

Entrez Gene ID: 79782

UniProt ID: Q6UY01

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000114248

More Information
SKU	ATLAPrEST95626-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95626-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	79782
Product information (PDF)	Download
MSDS (PDF)	Download