Skip to the beginning of the images gallery

PrEST Antigen METTL13

Name: PrEST Antigen METTL13
Brand: Atlas Antibodies
SKU: ATLAPrEST95609-100

methyltransferase 13, eEF1A lysine and N-terminal methyltransferase

SKU

ATLAPrEST95609-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: METTL13

Sequence: MLAEVGRVLQVGGRYLCISLAQAHILKKAVGHFSREGWMVRVHQVANSQDQVLEAEPQFSLPVFAFIMTKFRPVPGSALQIFELCA

Interspecies Mouse/Rat: ENSMUSG00000026694: 92%, ENSRNOG00000016965: 24%

Entrez Gene ID: 51603

UniProt ID: Q8N6R0

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000010165

More Information
SKU	ATLAPrEST95609-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95609-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	51603
Product information (PDF)	Download
MSDS (PDF)	Download