Skip to the beginning of the images gallery

PrEST Antigen METTL3

Name: PrEST Antigen METTL3
Brand: Atlas Antibodies
SKU: ATLAPrEST95801-100

methyltransferase 3, N6-adenosine-methyltransferase complex catalytic subunit

SKU

ATLAPrEST95801-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: METTL3

Sequence: KEHCLVGVKGNPQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLDGIHLLDPDVVARFKQRYPDGII

Interspecies Mouse/Rat: ENSMUSG00000022160: 100%, ENSRNOG00000013111: 98%

Entrez Gene ID: 56339

UniProt ID: Q86U44

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000165819

More Information
SKU	ATLAPrEST95801-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95801-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	56339
Product information (PDF)	Download
MSDS (PDF)	Download