Skip to the beginning of the images gallery

PrEST Antigen N4BP2L1

Name: PrEST Antigen N4BP2L1
Brand: Atlas Antibodies
SKU: ATLAPrEST95951-100

NEDD4 binding protein 2 like 1

SKU

ATLAPrEST95951-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: N4BP2L1

Sequence: SGKTTLARQLQHDFPRALIFSTDDFFFREDGAYEFNPDFLEEAHEWNQ

Interspecies Mouse/Rat: ENSMUSG00000041132: 90%, ENSRNOG00000059322: 92%

Entrez Gene ID: 90634

UniProt ID: Q5TBK1

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000139597

More Information
SKU	ATLAPrEST95951-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95951-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	90634
Product information (PDF)	Download
MSDS (PDF)	Download