Skip to the beginning of the images gallery

PrEST Antigen NCCRP1

Name: PrEST Antigen NCCRP1
Brand: Atlas Antibodies
SKU: ATLAPrEST95637-100

NCCRP1, F-box associated domain containing

SKU

ATLAPrEST95637-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: NCCRP1

Sequence: WEELLDDEQPAITVMDWFEDSRLDACVYELHVWLLAADRRTVIAQHHVA

Interspecies Mouse/Rat: ENSMUSG00000047586: 94%, ENSRNOG00000054506: 94%

Entrez Gene ID: 342897

UniProt ID: Q6ZVX7

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000188505

More Information
SKU	ATLAPrEST95637-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95637-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	342897
Product information (PDF)	Download
MSDS (PDF)	Download