PrEST Antigen NHSL2

NHS like 2

GeneName: NHSL2

Sequence: SKSISLRKAKKKPSPPTRSVSLVKDEPGLLPEGGSALPKDQRPKSLCLSLEHQGHHSSHPDAQGHPAIPNHKDPESTQFSHHWY

Interspecies Mouse/Rat: ENSRNOG00000058733: 29%, ENSMUSG00000079481: 83%

Entrez Gene ID: 340527

UniProt ID: Q5HYW2

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000204131

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• SKU: ATLAPrEST96152-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: APrEST96152-100
• Package Unit: 100 µl
• Quantity Unit: STK
• Human Gene ID: 340527