Skip to the beginning of the images gallery

PrEST Antigen PACS1

Name: PrEST Antigen PACS1
Brand: Atlas Antibodies
SKU: ATLAPrEST96148-100

phosphofurin acidic cluster sorting protein 1

SKU

ATLAPrEST96148-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: PACS1

Sequence: GSVDSKYSSSFLDSGWRDLFSRSEPPVSEQLDVAGRVMQYVNGAATTHQLP

Interspecies Mouse/Rat: ENSRNOG00000020350: 88%, ENSMUSG00000024855: 88%

Entrez Gene ID: 55690

UniProt ID: Q6VY07

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000175115

More Information
SKU	ATLAPrEST96148-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96148-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	55690
Product information (PDF)	Download
MSDS (PDF)	Download