Skip to the beginning of the images gallery

PrEST Antigen PLAAT5

Name: PrEST Antigen PLAAT5
Brand: Atlas Antibodies
SKU: ATLAPrEST95776-100

phospholipase A and acyltransferase 5

SKU

ATLAPrEST95776-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: PLAAT5

Sequence: LVQLPAKQPPPGTLEQGRSIQQGEKAVVSLETTPSQKADWSSIPKPENEGKLIKQAAEGKPRPRPG

Interspecies Mouse/Rat: ENSMUSG00000024973: 50%, ENSRNOG00000023528: 38%

Entrez Gene ID: 117245

UniProt ID: Q96KN8

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000168004

More Information
SKU	ATLAPrEST95776-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95776-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	117245
Product information (PDF)	Download
MSDS (PDF)	Download