Skip to the beginning of the images gallery

PrEST Antigen PRUNE2

Name: PrEST Antigen PRUNE2
Brand: Atlas Antibodies
SKU: ATLAPrEST96130-100

prune homolog 2 with BCH domain

SKU

ATLAPrEST96130-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: PRUNE2

Sequence: AFDHSFSDASGLNTSTGTIDDMSKLTLSEGHPETPVDGDLGKQDICSSEASWGDFEYDVMGQNIDEDLLREPEHFLYGGDPPLEEDSLKQSLAPYTPPFDLSYLTEPAQSAETIEEAGSPEDESLGCRAAEIVLSALPDR

Interspecies Mouse/Rat: ENSRNOG00000014664: 23%, ENSMUSG00000039126: 82%

Entrez Gene ID: 158471

UniProt ID: Q8WUY3

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000106772

More Information
SKU	ATLAPrEST96130-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96130-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	158471
Product information (PDF)	Download
MSDS (PDF)	Download