Skip to the beginning of the images gallery

PrEST Antigen RAB24

Name: PrEST Antigen RAB24
Brand: Atlas Antibodies
SKU: ATLAPrEST95665-100

RAB24, member RAS oncogene family

SKU

ATLAPrEST95665-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: RAB24

Sequence: KAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQDYA

Interspecies Mouse/Rat: ENSMUSG00000034789: 100%, ENSRNOG00000016539: 100%

Entrez Gene ID: 53917

UniProt ID: Q969Q5

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000169228

More Information
SKU	ATLAPrEST95665-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95665-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	53917
Product information (PDF)	Download
MSDS (PDF)	Download