Skip to the beginning of the images gallery

PrEST Antigen RAMP3

Name: PrEST Antigen RAMP3
Brand: Atlas Antibodies
SKU: ATLAPrEST96088-100

receptor activity modifying protein 3

SKU

ATLAPrEST96088-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: RAMP3

Sequence: SFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEV

Interspecies Mouse/Rat: ENSRNOG00000053766: 90%, ENSMUSG00000041046: 88%

Entrez Gene ID: 10268

UniProt ID: O60896

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000122679

More Information
SKU	ATLAPrEST96088-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96088-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	10268
Product information (PDF)	Download
MSDS (PDF)	Download