Skip to the beginning of the images gallery

PrEST Antigen RBMY1F

Name: PrEST Antigen RBMY1F
Brand: Atlas Antibodies
SKU: ATLAPrEST95767-100

RNA binding motif protein Y-linked family 1 member F

SKU

ATLAPrEST95767-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: RBMY1F

Sequence: WRNDRMSTRHDGYATNDGNHPSCQETRDYA

Interspecies Mouse/Rat: ENSRNOG00000000866: 44%, ENSMUSG00000049235: 44%

Entrez Gene ID: 159163

UniProt ID: Q15415

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000169800

More Information
SKU	ATLAPrEST95767-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95767-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	159163
Product information (PDF)	Download
MSDS (PDF)	Download