Skip to the beginning of the images gallery

PrEST Antigen STAU2

Name: PrEST Antigen STAU2
Brand: Atlas Antibodies
SKU: ATLAPrEST95800-100

staufen double-stranded RNA binding protein 2

SKU

ATLAPrEST95800-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: STAU2

Sequence: CSPVQPSKQLEYLARIQGFQAALSALKQFSEQGLDPIDGAMNIEKGSLEKQAKHLREKADNNQAPPGSIAQDCKKSNS

Interspecies Mouse/Rat: ENSRNOG00000003428: 26%, ENSMUSG00000025920: 88%

Entrez Gene ID: 27067

UniProt ID: Q9NUL3

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000040341

More Information
SKU	ATLAPrEST95800-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95800-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	27067
Product information (PDF)	Download
MSDS (PDF)	Download