Skip to the beginning of the images gallery

PrEST Antigen SUGT1

Name: PrEST Antigen SUGT1
Brand: Atlas Antibodies
SKU: ATLAPrEST95786-100

SGT1 homolog, MIS12 kinetochore complex assembly cochaperone

SKU

ATLAPrEST95786-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: SUGT1

Sequence: GITGADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDY

Interspecies Mouse/Rat: ENSRNOG00000012594: 73%, ENSMUSG00000022024: 72%

Entrez Gene ID: 10910

UniProt ID: Q9Y2Z0

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000165416

More Information
SKU	ATLAPrEST95786-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95786-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	10910
Product information (PDF)	Download
MSDS (PDF)	Download