Skip to the beginning of the images gallery

PrEST Antigen TICAM1

Name: PrEST Antigen TICAM1
Brand: Atlas Antibodies
SKU: ATLAPrEST96014-100

TIR domain containing adaptor molecule 1

SKU

ATLAPrEST96014-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: TICAM1

Sequence: RLDKHSQIFARKVANTFKPHRLQARKAMWRKEQDTRALREQSQHLDGERMQAAALNAAYSAYLQSYLSYQAQMEQLQVAFGSHMSFGTGAPYGARM

Interspecies Mouse/Rat: ENSMUSG00000047123: 52%, ENSRNOG00000019367: 24%

Entrez Gene ID: 148022

UniProt ID: Q8IUC6

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000127666

More Information
SKU	ATLAPrEST96014-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96014-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	148022
Product information (PDF)	Download
MSDS (PDF)	Download