Skip to the beginning of the images gallery

PrEST Antigen TNK2

Name: PrEST Antigen TNK2
Brand: Atlas Antibodies
SKU: ATLAPrEST95953-100

tyrosine kinase non receptor 2

SKU

ATLAPrEST95953-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: TNK2

Sequence: PQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGRAENYWWRGQNTRTLCVGPFPRNVVTSVAGLSAQDISQPLQNSFIHTGHG

Interspecies Mouse/Rat: ENSMUSG00000022791: 100%, ENSRNOG00000001769: 100%

Entrez Gene ID: 10188

UniProt ID: Q07912

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000061938

More Information
SKU	ATLAPrEST95953-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95953-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	10188
Product information (PDF)	Download
MSDS (PDF)	Download