PrEST Antigen ZNF226

zinc finger protein 226

GeneName: ZNF226

Sequence: QRLNRDQQISIKNKLCQCKKGVDPIGWISHHDGHRVHKSEKSYRPNDYEKDNMKILTFDHNSMIHTGHK

Interspecies Mouse/Rat: ENSRNOG00000019416: 36%, ENSMUSG00000047473: 33%

Entrez Gene ID: 7769

UniProt ID: Q9NYT6

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000167380

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• SKU: ATLAPrEST96237-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: APrEST96237-100
• Package Unit: 100 µl
• Quantity Unit: STK
• Human Gene ID: 7769