PRKAA2 Antibody - middle region : Biotin

PRKAA2 Antibody - middle region : Biotin
SKU
AVIARP56697_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a catalytic subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRKAA2

Key Reference: Qin,S. (2008) J. Biol. Chem. 283 (11), 6744-6751

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 5'-AMP-activated protein kinase catalytic subunit alpha-2

Protein Size: 552

Purification: Affinity Purified

Subunit: alpha-2
More Information
SKU AVIARP56697_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56697_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5563
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×