PRKAA2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a catalytic subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRKAA2

Key Reference: Qin,S. (2008) J. Biol. Chem. 283 (11), 6744-6751

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 5'-AMP-activated protein kinase catalytic subunit alpha-2

Protein Size: 552

Purification: Affinity Purified

Subunit: alpha-2

• SKU: AVIARP56697_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56697_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5563
• Host: Rabbit