Prkab2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Prkab2 is a component of the AMPK alpha2beta2gamma1 complex which phosphorylates glycogen synthase.

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: HKIMVGSTDDPSVFSLPDSKLPGDKEFVPWQQDLDDSVKPTQQARPTVIR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 5'-AMP-activated protein kinase subunit beta-2

Protein Size: 271

Purification: Affinity Purified

Subunit: beta-2

• SKU: AVIARP56638_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56638_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 64562
• Host: Rabbit