PRKCB1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in d

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKCB1

Key Reference: Tatematsu,K., (2008) J. Biol. Chem. 283 (17), 11575-11585

Molecular Weight: 77kDa

Peptide Sequence: Synthetic peptide located within the following region: MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein kinase C beta type

Protein Size: 673

Purification: Affinity Purified

• SKU: AVIARP56423_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56423_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5579
• Host: Rabbit