Prkch Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: This is calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 75kDa

Peptide Sequence: Synthetic peptide located within the following region: TPDYIAPEILQEMLYGPAVDWWAMGVLLYEMLCGHAPFEAENEDDLFEAI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein kinase C eta type

Protein Size: 683

Purification: Affinity Purified

• SKU: AVIARP56704_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56704_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 18755
• Host: Rabbit