PRKX Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a serine threonine protein kinase that has similarity to the catalytic subunit of cyclic AMP dependent protein kinases. The encoded protein is developmentally regulated and may be involved in renal epithelial morphogenesis. This protein

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKX

Key Reference: Li,X., (2008) Biochim. Biophys. Acta 1782 (1), 1-9

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cAMP-dependent protein kinase catalytic subunit PRKX

Protein Size: 358

Purification: Affinity Purified

• SKU: AVIARP56626_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56626_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5613
• Host: Rabbit