PRKY Antibody - N-terminal region : HRP

PRKY Antibody - N-terminal region : HRP
SKU
AVIARP56441_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene is similar to the protein kinase, X-linked gene in the pseudoautosomal region of the X chromsoome. The gene is classified as a transcribed pseudogene because it has lost a coding exon that results in all transcripts being candidates for nonsense

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKY

Key Reference: Skaletsky,H., (2003) Nature 423 (6942), 825-837

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPEAPAYRLQDCD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Size: 277

Purification: Affinity Purified
More Information
SKU AVIARP56441_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56441_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5616
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×