Pros1 Antibody - C-terminal region : Biotin

Pros1 Antibody - C-terminal region : Biotin
SKU
AVIARP56098_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Pros1 is a component of the Protein C/Protein S anticoagulant system; human homolog interacts with factor Xa, factor Va, and phospholipids to inhibit prothrombin activation.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 74kDa

Peptide Sequence: Synthetic peptide located within the following region: LGGVPDISFSATPVNAFYSGCMEVNINGVQLDLDEAISKHNDIRAHSCPS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vitamin K-dependent protein S

Protein Size: 675

Purification: Affinity Purified
More Information
SKU AVIARP56098_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56098_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 81750
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×