Pros1 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Pros1 is a component of the Protein C/Protein S anticoagulant system; human homolog interacts with factor Xa, factor Va, and phospholipids to inhibit prothrombin activation.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 74kDa

Peptide Sequence: Synthetic peptide located within the following region: LGGVPDISFSATPVNAFYSGCMEVNINGVQLDLDEAISKHNDIRAHSCPS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vitamin K-dependent protein S

Protein Size: 675

Purification: Affinity Purified

• SKU: AVIARP56098_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56098_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 81750
• Host: Rabbit