PROS1 Antibody - middle region : FITC

PROS1 Antibody - middle region : FITC
SKU
AVIARP56097_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PROS1 is an anticoagulant plasma protein; it is a cofactor to activated protein C in the degradation of coagulation factors Va and VIIIa. It helps to prevent coagulation and stimulating fibrinolysis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PROS1

Key Reference: Ten (2008) Hum. Mutat. 29 (7), 939-947

Molecular Weight: 71kDa

Peptide Sequence: Synthetic peptide located within the following region: MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vitamin K-dependent protein S

Protein Size: 676

Purification: Affinity Purified
More Information
SKU AVIARP56097_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56097_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 5627
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×