PROS1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: PROS1 is an anticoagulant plasma protein; it is a cofactor to activated protein C in the degradation of coagulation factors Va and VIIIa. It helps to prevent coagulation and stimulating fibrinolysis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PROS1

Key Reference: Ten (2008) Hum. Mutat. 29 (7), 939-947

Molecular Weight: 71kDa

Peptide Sequence: Synthetic peptide located within the following region: MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Vitamin K-dependent protein S

Protein Size: 676

Purification: Affinity Purified

• SKU: AVIARP56097_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56097_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 5627
• Host: Rabbit