PROSER2 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human PROSER2

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: LCFRPGPALPSTRARQSFPGPRQPNGAQDWRRADSLPRPQGITVQFAGRG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: proline and serine-rich protein 2

Protein Size: 239

Purification: Affinity Purified

• SKU: AVIARP55576_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55576_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 254427
• Host: Rabbit