PRPH Antibody - middle region : Biotin

PRPH Antibody - middle region : Biotin
SKU
AVIARP56708_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin, and is a different protein that the pe

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRPH

Key Reference: Xiao,S., (2008) J. Neurosci. 28 (8), 1833-1840

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: YKSKYADLSDAANRNHEALRQAKQEMNESRRQIQSLTCEVDGLRGTNEAL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peripherin

Protein Size: 470

Purification: Affinity Purified
More Information
SKU AVIARP56708_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56708_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5630
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×