PRPH Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin, and is a different protein that the pe

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRPH

Key Reference: Xiao,S., (2008) J. Neurosci. 28 (8), 1833-1840

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: RFANFIEKVRFLEQQNAALRGELSQARGQEPARADQLCQQELRELRRELE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peripherin

Protein Size: 470

Purification: Affinity Purified

• SKU: AVIARP56707_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56707_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5630
• Host: Rabbit