PRPSAP2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The enzyme phosphoribosylpyrophosphate synthetase (PRS) catalyzes the formation of phosphoribosylpyrophosphate which is a substrate for synthesis of purine and pyrimidine nucleotides, histidine, tryptophan and NAD. PRS exists as a complex with two catalytic subunits and two associated subunits. This gene encodes a non-catalytic associated subunit of PRS.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRPSAP2

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: DYRNAVIVAKSPASAKRAQSFAERLRLGIAVIHGEAQDAESDLVDGRHSP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Phosphoribosyl pyrophosphate synthase-associated protein 2

Protein Size: 369

Purification: Affinity Purified

• SKU: AVIARP56446_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56446_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5636
• Host: Rabbit