PRR13 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: PRR13 negatively regulates TSP1 expression at the level of transcription. This down-regulation was shown to reduce taxane-induced apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRR13

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: PFPPGPCPPPPGAPHGNPAFPPGGPPHPVPQPGYPGCQPLGPYPPPYPPP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Proline-rich protein 13

Protein Size: 148

Purification: Affinity Purified

• SKU: AVIARP57260_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57260_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54458
• Host: Rabbit