PRR16 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRR16

Key Reference: Barberi,T., PLoS Med. 2 (6), E161 (2005)

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: RERVRFNEKVQYHGYCPDCDTRYNIKNREVHLHSEPVHPPGKIPHQGPPL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Proline-rich protein 16

Protein Size: 281

Purification: Affinity Purified

• SKU: AVIARP56956_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56956_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51334
• Host: Rabbit