PRSS22 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the trypsin family of serine proteases. The enzyme is expressed in the airways in a developmentally regulated manner. The gene is part of a cluster of serine protease genes on chromosome 16.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRSS22

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: IPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Brain-specific serine protease 4

Protein Size: 317

Purification: Affinity Purified

• SKU: AVIARP57603_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57603_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 64063
• Host: Rabbit