PRSS3 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is expressed in the brain and pancreas and is resistant to common trypsin inhibitors. It is active on peptide linkages involving the carboxyl group of lysine or arginine. This gene is localized to the locus of T cell receptor beta variable orphans on chromosome 9. Four transcript variants encoding different isoforms have been described for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRSS3

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Trypsin-3

Protein Size: 304

Purification: Affinity Purified

• SKU: AVIARP56447_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56447_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5646
• Host: Rabbit