PRSS3 Antibody - N-terminal region : FITC

PRSS3 Antibody - N-terminal region : FITC
SKU
AVIARP56447_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is expressed in the brain and pancreas and is resistant to common trypsin inhibitors. It is active on peptide linkages involving the carboxyl group of lysine or arginine. This gene is localized to the locus of T cell receptor beta variable orphans on chromosome 9. Four transcript variants encoding different isoforms have been described for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRSS3

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Trypsin-3

Protein Size: 304

Purification: Affinity Purified
More Information
SKU AVIARP56447_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56447_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5646
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×