PRSS8 Antibody - middle region : Biotin

PRSS8 Antibody - middle region : Biotin
SKU
AVIARP56449_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is highly expressed in prostate epithelia and is one of several proteolytic enzymes found in seminal fluid. The proprotein is cleaved to produce a light chain and a heavy chain which are associated by a disulfide bond. It is active on peptide linkages involving the carboxyl group of lysine or arginine.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRSS8

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: PITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Prostasin

Protein Size: 343

Purification: Affinity Purified
More Information
SKU AVIARP56449_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56449_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5652
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×