PSCD4 Antibody - N-terminal region : FITC

PSCD4 Antibody - N-terminal region : FITC
SKU
AVIARP54947_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PSCD4 promotes guanine-nucleotide exchange on ARF1 and ARF5. PSCD4 promotes the activation of ARF through replacement of GDP with GTP.Pleckstrin homology, Sec7 and coiled/coil domains 4 (PSCD4) is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The PSCD4 exhibits GEP activity in vitro with both ARF1 and ARF5 but is inactive with ARF6. The PSCD4 and PSCD1 gene structures are very similar.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSCD4

Key Reference: Morishige,M., (2008) Nat. Cell Biol. 10 (1), 85-92

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: NKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytohesin-4

Protein Size: 394

Purification: Affinity Purified
More Information
SKU AVIARP54947_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54947_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27128
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×