PSEN2 Antibody - C-terminal region : HRP

PSEN2 Antibody - C-terminal region : HRP
SKU
AVIARP58940_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes. Two alternatively spliced transcript variants encoding different isoforms of PSEN2 have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human PSEN2

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: PYDPEMEEDSYDSFGEPSYPEVFEPPLTGYPGEELEEEEERGVKLGLGDF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: presenilin-2

Protein Size: 304

Purification: Affinity Purified
More Information
SKU AVIARP58940_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58940_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5664
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×