PSMA5 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PSMA5

Key Reference: Beausoleil,S.A., (2006) Nat. Biotechnol. 24 (10), 1285-1292

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: FGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Proteasome subunit alpha type-5

Protein Size: 241

Purification: Affinity Purified

Subunit: alpha type-5

• SKU: AVIARP56456_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56456_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5686
• Host: Rabbit