PSMB6 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSMB6

Key Reference: Listovsky,T., (2004) EMBO J. 23 (7), 1619-1626

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proteasome subunit beta type-6

Protein Size: 239

Purification: Affinity Purified

Subunit: beta type-6

• SKU: AVIARP56469_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56469_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5694
• Host: Rabbit