Psmc1 Antibody - C-terminal region : FITC

Psmc1 Antibody - C-terminal region : FITC
SKU
AVIARP56476_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The 26S protease is involved in the ATP-dependent degradation of ubiquitinated proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 26S protease regulatory subunit 4

Protein Size: 440

Purification: Affinity Purified

Subunit: 4
More Information
SKU AVIARP56476_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56476_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 19179
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×