Psmc1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The 26S protease is involved in the ATP-dependent degradation of ubiquitinated proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex.

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: YLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 26S protease regulatory subunit 4

Protein Size: 440

Purification: Affinity Purified

Subunit: 4

• SKU: AVIARP56475_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56475_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 19179
• Host: Rabbit