PSMC3 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PSMC3 is a subunit of the 26S proteasome. 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. This subunit may compete with PSMC2 for binding to the HIV tat protein to regulate the interaction between the viral protein and the transcription complex.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSMC3

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: KDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 26S protease regulatory subunit 6A

Protein Size: 439

Purification: Affinity Purified

Subunit: 6A

• SKU: AVIARP58176_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58176_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5702
• Host: Rabbit