PSMD10 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PSMD10

Key Reference: Umemura,A., (2008) Hepatology 47 (2), 493-502

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: MHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 26S proteasome non-ATPase regulatory subunit 10

Protein Size: 226

Purification: Affinity Purified

Subunit: 10

• SKU: AVIARP56482_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56482_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5716
• Host: Rabbit