Psmd10 Antibody - N-terminal region : FITC

Psmd10 Antibody - N-terminal region : FITC
SKU
AVIARP56481_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Psmd10 acts as a chaperone during the assembly of the 26S proteasome, specifically of the PA700/19S regulatory complex (RC). In the initial step of the base subcomplex assembly,Psmd10 is part of an intermediate PSMD10:PSMC4:PSMC5:PAAF1 module which probably assembles with a PSMD5:PSMC2:PSMC1:PSMD2 module By similarity.Psmd10 acts as an oncoprotein by being involved in negative regulation of tumor suppressors RB1 and p53/TP53. Overexpression of this gene is leading to phosphorylation of RB1 and proteasomal degradation of RB1. Psmd10 regulates CDK4-mediated phosphorylation of RB1 by competing with CDKN2A for binding with CDK4.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: KERILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 26S proteasome non-ATPase regulatory subunit 10

Protein Size: 231

Purification: Affinity Purified

Subunit: 10
More Information
SKU AVIARP56481_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56481_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 53380
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×