PSMD4 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the non-ATPase subunits of the 19S regulator lid.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PSMD4

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: EEQIAYAMQMSLQGAEFGQAESADIDASSAMDTSEPAKEEDDYDVMQDPE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 26S proteasome non-ATPase regulatory subunit 4

Protein Size: 377

Purification: Affinity Purified

• SKU: AVIARP58059_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58059_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5710
• Host: Rabbit