PTK6 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a cytoplasmic nonreceptor protein kinase which may function as an intracellular signal transducer in epithelial tissues. Overexpression of this gene in mammary epithelial cells leads to sensitization of the cells to epi

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PTK6

Key Reference: Lukong,K.E. (2008) Cell. Signal. 20 (2), 432-442

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: SELLDIAWQVAEGMCYLESQNYIHRDLAARNILVGENTLCKVGDFGLARL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein-tyrosine kinase 6

Protein Size: 451

Purification: Affinity Purified

• SKU: AVIARP56657_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56657_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5753
• Host: Rabbit